SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000206595 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000206595
Domain Number 1 Region: 344-691
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.4e-39
Family Hect, E3 ligase catalytic domain 0.012
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.91e-28
Family PHD domain 0.00074
Further Details:      
 
Weak hits

Sequence:  ENSP00000206595
Domain Number - Region: 138-199
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0048
Family PHD domain 0.023
Further Details:      
 
Domain Number - Region: 68-106
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00767
Family PHD domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000206595   Gene: ENSG00000092140   Transcript: ENST00000206595
Sequence length 706
Comment pep:known chromosome:GRCh38:14:30559123:30620063:1 gene:ENSG00000092140 transcript:ENST00000206595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNF
ASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTICNNSDIFQKEMLRMGIHIPEKDASWELEENAYQELLQHYERCDVRRCRC
KEGRDYNAPDSKWEIKRCQCCGSSGTHLACSSLRSWEQNWECLECRGIIYNSGEFQKAKK
HVLPNSNNVGITDCLLEESSPKLPRQSPGSQSKDLLRQGSKFRRNVSTLLIELGFQIKKK
TKRLYINKANIWNSALDAFRNRNFNPSYAIEVAYVIENDNFGSEHPGSKQEFLSLLMQHL
ENSSLFEGSLSKNLSLNSQALKENLYYEAGKMLAISLVHGGPSPGFFSKTLFNCLVYGPE
NTQPILDDVSDFDVAQIIIRINTATTVADLKSIINECYNYLELIGCLRLITTLSDKYMLV
KDILGYHVIQRVHTPFESFKQGLKTLGVLEKIQAYPEAFCSILCHKPESLSAKILSELFT
VHTLPDVKALGFWNSYLQAVEDGKSTTTMEDILIFATGCSSIPPAGFKPTPSIECLHVDF
PVGNKCNNCLAIPITNTYKEFQENMDFTIRNTLRLEKEESSHYIGH
Download sequence
Identical sequences Q7L622
9606.ENSP00000206595 NYSGRC-33620749 gi|33620749|ref|NP_060239.2| ENSP00000206595 NP_060239.2.87134 NP_060239.2.92137 XP_011535227.1.92137 ENSP00000206595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]