SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000207870 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000207870
Domain Number 1 Region: 10-287
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.08e-38
Family Glycerol kinase 0.025
Further Details:      
 
Domain Number 2 Region: 290-523
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 4.29e-32
Family Glycerol kinase 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000207870   Gene: ENSG00000093217   Transcript: ENST00000207870
Sequence length 536
Comment pep:known chromosome:GRCh38:3:38346779:38414976:1 gene:ENSG00000093217 transcript:ENST00000207870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHAPRRCCLGWDFSTQQVKVVAVDAELNVFYEESVHFDRDLPEFGTQGGVHVHKDGLT
VTSPVLMWVQALDIILEKMKASGFDFSQVLALSGAGQQHGSIYWKAGAQQALTSLSPDLR
LHQQLQDCFSISDCPVWMDSSTTAQCRQLEAAVGGAQALSCLTGSRAYERFTGNQIAKIY
QQNPEAYSHTERISLVSSFAASLFLGSYSPIDYSDGSGMNLLQIQDKVWSQACLGACAPH
LEEKLSPPVPSCSVVGAISSYYVQRYGFPPGCKVVAFTGDNPASLAGMRLEEGDIAVSLG
TSDTLFLWLQEPMPALEGHIFCNPVDSQHYMALLCFKNGSLMREKIRNESVSRSWSDFSK
ALQSTEMGNGGNLGFYFDVMEITPEIIGRHRFNTENHKVAAFPGDVEVRALIEGQFMAKR
IHAEGLGYRVMSKTKILATGGASHNREILQVLADVFDAPVYVIDTANSACVGSAYRAFHG
LAGGTDVPFSEVVKLAPNPRLAATPSPGASQVYEALLPQYAKLEQRILSQTRGPPE
Download sequence
Identical sequences O75191
ENSP00000398845 NP_005099.2.87134 NP_005099.2.92137 9606.ENSP00000207870 gi|18860918|ref|NP_005099.2| ENSP00000207870 Hs18860918___KOG2531 ENSP00000207870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]