SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216085 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216085
Domain Number 1 Region: 20-180
Classification Level Classification E-value
Superfamily Rhomboid-like 0.00000000000628
Family Rhomboid-like 0.0064
Further Details:      
 
Domain Number 2 Region: 315-362
Classification Level Classification E-value
Superfamily UBA-like 0.00000108
Family UBA domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216085   Gene: ENSG00000100263   Transcript: ENST00000216085
Sequence length 386
Comment pep:known chromosome:GRCh38:22:29259852:29267978:-1 gene:ENSG00000100263 transcript:ENST00000216085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQVLQEGVLCRTLAGCWPLRLLATPGSLAELPVTHPAGVRPPIPGPPY
VASPDLWSHWEDSALPPPSLRPVQPTWEGSSEAGLDWAGASFSPGTPMWAALDEQMLQEG
IQASLLDGPAQEPQSAPWLSKSSVSSLRLQQLERMGFPTEQAVVALAATGRVEGAVSLLV
GGQVGTETLVTHGKGGPAHSEGPGPP
Download sequence
Identical sequences A0A024R1J2 Q9Y3P4
9606.ENSP00000216085 gi|11072101|ref|NP_036397.1| NP_036397.1.87134 NP_036397.1.92137 XP_011528409.1.92137 ENSP00000216085 ENSP00000216085 ENSP00000216085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]