SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000216468 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000216468
Domain Number 1 Region: 180-225,265-324
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 4.84e-30
Family Supernatant protein factor (SPF), C-terminal domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000216468   Gene: ENSG00000100580   Transcript: ENST00000216468
Sequence length 325
Comment pep:known chromosome:GRCh38:14:77335021:77377109:-1 gene:ENSG00000100580 transcript:ENST00000216468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDLQAAEGPGSWSPTARPGSAGGVGDCQGVEGSQAAASENEDLENKDTSLLASATDPEP
CSSPHRPQMVSPVSKDATEDLRKATGPLEAQALVKQDLLPADQAQVLNEMAKYQVPQRSG
DIVMIQSEHTGAIDVLSADLESADLLGDHRKVSPPLMAPPCIWTFAKVKEFKSKLGKEKN
SRLVVKRGEVVTIRVPTHPEGKRVCWEFATDDYDIGFGVYFDWTPVTSTDITVQVSDSSD
DEDEEEEEEEEIEEPVPAGDVERGSRSSLRGRYGEVMPVYRRDSHRDVQAGSHDYPGEGI
YLLKFDNSYSLLRNKTLYFHIYYTS
Download sequence
Identical sequences Q6PL24
ENSP00000216468 NP_998766.1.87134 NP_998766.1.92137 ENSP00000216468 9606.ENSP00000216468 gi|47106067|ref|NP_998766.1| ENSP00000216468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]