SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000221327 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000221327
Domain Number 1 Region: 529-586
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-27
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 
Domain Number 2 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.59e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.94e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 585-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 336-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.04e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 6 Region: 627-679
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-20
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 492-524
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000011
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 66-124
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000183
Family KRAB domain (Kruppel-associated box) 0.0054
Further Details:      
 
Domain Number 9 Region: 281-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000398
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000221327   Gene: ENSG00000167384   Transcript: ENST00000221327
Sequence length 692
Comment pep:known chromosome:GRCh38:19:44475637:44500522:-1 gene:ENSG00000167384 transcript:ENST00000221327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRACAGSTREAGSGAQDLSTLLCLEESMEEQDEKPPEPPKVCAQDSFLPQEIIIKVEGED
TGSLTIPSQEGVNFKIVTVDFTREEQGTCNPAQRTLDRDVILENHRDLVSWDLATAVGKK
DSTSKQRIFDEEPANGVKIERFTRDDPWLSSCEEVDDCKDQLEKQQEKQEILLQEVAFTQ
RKAVIHERVCKSDETGEKSGLNSSLFSSPVIPIRNHFHKHVSHAKKWHLNAAVNSHQKIN
ENETLYENNECGKPPQSIHLIQFTRTQTKDKSYGFSDRIQSFCHGTPLHIHEKIHGGGKT
FDFKECGQVLNPKISHNEQQRIPFEESQYKCSETSHSSSLTQNMRNNSEEKPFECNQCGK
SFSWSSHLVAHQRTHTGEKPYECSECGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQ
SYVLVVHQRTHTGEKPYECNQCGKSFRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKL
IAHQRIHTGEKPYECNQCGKSFSQSYKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQ
RTHTGEKPYECSECGKSFNRSSHLVMHQRIHTGEKPYECNQCGKSFSQSYVLVVHQRTHT
GEKPYECSQCGKSFRQSSCLTQHQRTHTGEKPFECNQCGKTFSLSARLIVHQRTHTGEKP
FTCIQCGKAFINSYKLIRHQATHTEEKLYECN
Download sequence
Identical sequences NP_037388.3.87134 NP_037388.3.92137 ENSP00000221327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]