SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000225899 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000225899
Domain Number 1 Region: 334-405
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 2.96e-22
Family Intermediate filament protein, coiled coil region 0.0014
Further Details:      
 
Domain Number 2 Region: 94-129
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000575
Family Intermediate filament protein, coiled coil region 0.0026
Further Details:      
 
Domain Number 3 Region: 12-71,404-447
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000148
Family Growth factor receptor domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSP00000225899
Domain Number - Region: 207-321
Classification Level Classification E-value
Superfamily Prefoldin 0.000173
Family Prefoldin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000225899   Gene: ENSG00000108759   Transcript: ENST00000225899
Sequence length 448
Comment pep:known chromosome:GRCh38:17:41459811:41467429:-1 gene:ENSG00000108759 transcript:ENST00000225899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSCCVTNNLQASLKSCPRPASVCSSGVNCRPELCLGYVCQPMACLPSVCLPTTFRPAS
CLSKTYLSSSCQAASGISGSMGPGSWYSEGAFNGNEKETMQFLNDRLASYLTRVRQLEQE
NAELESRIQEASHSQVLTMTPDYQSHFRTIEELQQKILCTKAENARMVVNIDNAKLAADD
FRAKYEAELAMRQLVEADINGLRRILDDLTLCKADLEAQVESLKEELMCLKKNHEEEVGS
LRCQLGDRLNIEVDAAPPVDLTRVLEEMRCQYEAMVEANRRDVEEWFNMQMEELNQQVAT
SSEQLQNYQSDIIDLRRTVNTLEIELQAQHSLRDSLENTLTESEARYSSQLAQMQCMITN
VEAQLAEIRADLERQNQEYQVLLDVRARLEGEINTYRSLLENEDCKLPCNPCSTPSCTTC
VPSPCVPRTVCVPRTVGMPCSPCPQGRY
Download sequence
Identical sequences Q14532
9606.ENSP00000225899 ENSP00000225899 ENSP00000225899 gi|116488398|ref|NP_002269.3| NP_002269.3.87134 NP_002269.3.92137 ENSP00000225899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]