SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000247956 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000247956
Domain Number 1 Region: 52-113
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.5e-26
Family KRAB domain (Kruppel-associated box) 0.00052
Further Details:      
 
Domain Number 2 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.31e-23
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 500-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.67e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 7 Region: 548-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000175
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 8 Region: 175-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000651
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 9 Region: 390-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000388
Family Classic zinc finger, C2H2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000247956   Gene: ENSG00000130803   Transcript: ENST00000247956
Sequence length 595
Comment pep:known chromosome:GRCh38:19:9140380:9163413:1 gene:ENSG00000130803 transcript:ENST00000247956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALSPTFATSTQDSTCLQDSEFPVSSKDHSCPQNLDLFVCSGLEPHTPSVGSQESVTFQ
DVAVDFTEKEWPLLDSSQRKLYKDVMLENYSNLTSLGYQVGKPSLISHLEQEEEPRTEER
GAHQGACADWETPSKTKWSLLMEDIFGKETPSGVTMERAGLGEKSTEYAHLFEVFGMDPH
LTQPMGRHAGKRPYHRRDYGVAFKGRPHLTQHMSMYDGRKMHECHQCQKAFTTSASLTRH
RRIHTGEKPYECSDCGKAFNDPSALRSHARTHLKEKPFDCSQCGNAFRTLSALKIHMRVH
TGERPYKCDQCGKAYGRSCHLIAHKRTHTGERPYECHDCGKAFQHPSHLKEHVRNHTGEK
PYACTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFGDLVSRRKHMRIHIVKKPVEC
RQCGKTFRNQSILKTHMNSHTGEKPYGCDLCGKAFSASSNLTAHRKIHTQERRYECAACG
KVFGDYLSRRRHMSVHLVKKRVECRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAFS
IGSNLNVHRRIHTGEKPYECLVCGKAFSDHSSLRSHVKTHRGEKLFVSSVWKRLQ
Download sequence
Identical sequences A0A024R7B1 Q96PQ6
NP_065984.3.87134 NP_065984.3.92137 ENSP00000353554 gi|190610008|ref|NP_065984.3| ENSP00000247956 ENSP00000247956 9606.ENSP00000247956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]