SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000248901 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000248901
Domain Number 1 Region: 59-251
Classification Level Classification E-value
Superfamily Sec7 domain 7.98e-77
Family Sec7 domain 0.000000046
Further Details:      
 
Domain Number 2 Region: 259-380
Classification Level Classification E-value
Superfamily PH domain-like 8.04e-33
Family Pleckstrin-homology domain (PH domain) 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000248901   Gene: ENSG00000100055   Transcript: ENST00000248901
Sequence length 394
Comment pep:known chromosome:GRCh38:22:37282383:37315345:1 gene:ENSG00000100055 transcript:ENST00000248901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLCHPEPAELSSGETEELQRIKWHRKQLLEDIQKLKDEIADVFAQIDCFESAEESRMAQ
KEKELCIGRKKFNMDPAKGIQYFIEHKLLTPDVQDIARFLYKGEGLNKTAIGTYLGERDP
INLQVLQAFVDCHEFANLNLVQALRQFLWSFRLPGEAQKIDRMMEAFATRYCLCNPGVFQ
STDTCYVLSFSIIMLNTSLHNPNVRDRPPFERFVSMNRGINNGSDLPEDQLRNLFDSIKS
EPFSIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEFTTDKEPR
GIIPLENLSVQKVDDPKKPFCLELYNPSCRGQKIKACKTDGDGRVVEGKHESYRISATSA
EERDQWIESIRASITRVPFYDLVSTRKKKIASKQ
Download sequence
Identical sequences Q9UIA0
ENSP00000248901 ENSP00000384280 gi|7019505|ref|NP_037517.1| 9606.ENSP00000248901 ENSP00000248901 NP_037517.1.87134 NP_037517.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]