SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000248929 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000248929
Domain Number 1 Region: 96-262
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.78e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0054
Further Details:      
 
Domain Number 2 Region: 242-357
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.32e-24
Family Ypt/Rab-GAP domain of gyp1p 0.013
Further Details:      
 
Domain Number 3 Region: 481-543
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-18
Family SH3-domain 0.00084
Further Details:      
 
Domain Number 4 Region: 563-595,632-717
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000000000759
Family RUN domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000248929   Gene: ENSG00000100359   Transcript: ENST00000248929
Sequence length 749
Comment pep:known chromosome:GRCh38:22:40370611:40410289:1 gene:ENSG00000100359 transcript:ENST00000248929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSS
LLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMR
PQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTT
LLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDL
FFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEA
LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRS
HRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
ERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICV
GLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELP
AKREAQQPLKEGVRDMLVKHHLFSWDVDG
Download sequence
Identical sequences B9A6J5 Q96HU1
ENSP00000248929 ENSGGOP00000014805 ENSGGOP00000014805 ENSP00000248929 gi|29648315|ref|NP_056520.2| NP_056520.2.87134 NP_056520.2.92137 ENSP00000390998 9606.ENSP00000248929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]