SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000249364 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000249364
Domain Number 1 Region: 154-309
Classification Level Classification E-value
Superfamily EF-hand 4.96e-28
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 2 Region: 25-136
Classification Level Classification E-value
Superfamily EF-hand 1.33e-17
Family Calmodulin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000249364   Gene: ENSG00000128595   Transcript: ENST00000249364
Sequence length 315
Comment pep:known chromosome:GRCh38:7:128739342:128771474:1 gene:ENSG00000128595 transcript:ENST00000249364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQSFDYDHDAFLGAEEAKT
FDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNE
DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
Download sequence
Identical sequences A0A0D9RCF2 A0A2K5P6X5 A0A2K5V7F8 A0A2K6BGU9 A0A2K6QUH5 F6ZZ64 G2HHY3 G3QSQ0 O43852 Q6IAW5
ENSP00000249364 gi|4502551|ref|NP_001210.1| ENSP00000249364 ENSPANP00000016650 ENSPTRP00000033676 ENSMMUP00000012584 ENSPTRP00000033676 NP_001210.1.87134 NP_001210.1.92137 NP_001233521.1.37143 XP_003261346.1.23891 XP_003813555.1.60992 XP_004046225.2.27298 XP_007981043.1.81039 XP_010377044.1.97406 XP_011727596.1.29376 XP_011794947.1.43180 XP_011851299.1.47321 XP_011943384.1.92194 XP_012367652.1.23891 XP_014990297.1.72884 ENSMMUP00000012585 9544.ENSMMUP00000012585 9606.ENSP00000249364 ENSNLEP00000015065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]