SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261326 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261326
Domain Number 1 Region: 42-434,462-487
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.24e-59
Family Cystathionine synthase-like 0.0015
Further Details:      
 
Domain Number 2 Region: 584-715
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 8.37e-39
Family MOSC N-terminal domain-like 0.00095
Further Details:      
 
Domain Number 3 Region: 722-831
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000199
Family MOSC (MOCO sulphurase C-terminal) domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261326   Gene: ENSG00000075643   Transcript: ENST00000261326
Sequence length 888
Comment pep:known chromosome:GRCh38:18:36187519:36272157:1 gene:ENSG00000075643 transcript:ENST00000261326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAAAESGRELWTFAGSRDPSAPRLAYGYGPGSLRELRAREFSRLAGTVYLDHAGATLF
SQSQLESFTSDLMENTYGNPHSQNISSKLTHDTVEQVRYRILAHFHTTAEDYTVIFTAGS
TAALKLVAEAFPWVSQGPESSGSRFCYLTDSHTSVVGMRNVTMAINVISTPVRPEDLWSA
EERSASASNPDCQLPHLFCYPAQSNFSGVRYPLSWIEEVKSGRLHPVSTPGKWFVLLDAA
SYVSTSPLDLSAHQADFVPISFYKIFGFPTGLGALLVHNRAAPLLRKTYFGGGTASAYLA
GEDFYIPRQSVAQRFEDGTISFLDVIALKHGFDTLERLTGGMENIKQHTFTLAQYTYVAL
SSLQYPNGAPVVRIYSDSEFSSPEVQGPIINFNVLDDKGNIIGYSQVDKMASLYNIHLRT
GCFCNTGACQRHLGISNEMVRKHFQAGHVCGDNMDLIDGQPTGSVRISFGYMSTLDDVQA
FLRFIIDTRLHSSGDWPVPQAHADTGETGAPSADSQADVIPAVMGRRSLSPQEDALTGSR
VWNNSSTVNAVPVAPPVCDVARTQPTPSEKAAGVLEGALGPHVVTNLYLYPIKSCAAFEV
TRWPVGNQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGMEPIEV
PLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIKQSSNSQRNAKKKHG
KDQLPGTMATLSLVNEAQYLLINTSSILELHRQLNTSDENGKEELFSLKDLSLRFRANII
INGKRAFEEEKWDEISIGSLRFQVLGPCHRCQMICIDQQTGQRNQHVFQKLSESRETKVN
FGMYLMHASLDLSSPCFLSVGSQVLPVLKENVEGHDLPASEKHQDVTS
Download sequence
Identical sequences Q96EN8
ENSP00000261326 NP_060417.2.87134 NP_060417.2.92137 9606.ENSP00000261326 ENSP00000261326 NYSGRC-157388923 gi|157388923|ref|NP_060417.2| ENSP00000261326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]