SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000261889 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000261889
Domain Number 1 Region: 140-269
Classification Level Classification E-value
Superfamily PX domain 5.76e-32
Family PX domain 0.0011
Further Details:      
 
Domain Number 2 Region: 309-501
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000712
Family IMD domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000261889   Gene: ENSG00000028528   Transcript: ENST00000261889
Sequence length 557
Comment pep:putative chromosome:GRCh38:15:64095993:64139875:1 gene:ENSG00000028528 transcript:ENST00000261889 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGGGGCSASERLPPPFPGLEPESEGAAGGSEPEAGDSDTEGEDIFTGAAVVSKHQSPK
ITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQE
ATNSSKPQPTYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPLFRSKQ
FAVKRRFSDFLGLYEKLSEKHSQNGFIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRA
ALERYLQRIVNHPTMLQDPDVREFLEKEELPRAVGTQTLSGAGLLKMFNKATDAVSKMTI
KMNESDIWFEEKLQEVECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQANNDFFLLAELLSDYIRLLAIVRAAFDQRMKTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEILEWESRVTQYERDFERISTVVRKEVIR
FEKEKSKDFKNHVIKYLETLLYSQQQAGEQLGIRSGILLTKKLPRYSKFFSTVHKFCAAA
SLWKWGFFLSAYLSYLF
Download sequence
Identical sequences ENSP00000261889 ENSP00000261889 NP_001229862.1.87134 NP_001229862.1.92137 ENSP00000452652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]