SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000262547 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262547
Domain Number 1 Region: 619-724
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.64e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSP00000262547
Domain Number - Region: 265-310,339-386
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0837
Family Cytochrome c3-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262547   Gene: ENSG00000089091   Transcript: ENST00000262547
Sequence length 752
Comment pep:known chromosome:GRCh38:20:18383369:18467185:-1 gene:ENSG00000089091 transcript:ENST00000262547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGY
GENNTFKYIKPITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVL
KDSSRQEFKNGFVGSKLKKKYKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQS
QSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGC
RLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNP
AHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEASFCGWCGAML
GIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYW
RRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLY
LNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKE
QLIPENRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVL
VQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNT
GDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC
Download sequence
Identical sequences Q9NVP4
ENSP00000262547 ENSP00000351734 NYSGRC-150378537 ENSP00000262547 ENSP00000351734 gi|150378537|ref|NP_001092877.1| NP_001092877.1.87134 NP_001092877.1.92137 ENSP00000351734 9606.ENSP00000262547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]