SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000262919 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000262919
Domain Number 1 Region: 340-633
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 9.29e-43
Family Galactose oxidase, central domain 0.012
Further Details:      
 
Domain Number 2 Region: 783-929
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-23
Family C-type lectin domain 0.0031
Further Details:      
 
Domain Number 3 Region: 128-250
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-22
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 4 Region: 1063-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000402
Family Laminin-type module 0.0088
Further Details:      
 
Weak hits

Sequence:  ENSP00000262919
Domain Number - Region: 99-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000718
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 247-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family EGF-type module 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000262919   Gene: ENSG00000088812   Transcript: ENST00000262919
Sequence length 1429
Comment pep:known chromosome:GRCh38:20:3471040:3651122:1 gene:ENSG00000088812 transcript:ENST00000262919 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAAAAATEARLRRRTAATAALAGRSGGPHWDWDVTRAGRPGLGAGLRLPRLLSPPLRPR
LLLLLLLLSPPLLLLLLPCEAEAAAAAAAVSGSAAAEAKECDRPCVNGGRCNPGTGQCVC
PAGWVGEQCQHCGGRFRLTGSSGFVTDGPGNYKYKTKCTWLIEGQPNRIMRLRFNHFATE
CSWDHLYVYDGDSIYAPLVAAFSGLIVPERDGNETVPEVVATSGYALLHFFSDAAYNLTG
FNITYSFDMCPNNCSGRGECKISNSSDTVECECSENWKGEACDIPHCTDNCGFPHRGICN
SSDVRGCSCFSDWQGPGCSVPVPANQSFWTREEYSNLKLPRASHKAVVNGNIMWVVGGYM
FNHSDYNMVLAYDLASREWLPLNRSVNNVVVRYGHSLALYKDKIYMYGGKIDSTGNVTNE
LRVFHIHNESWVLLTPKAKEQYAVVGHSAHIVTLKNGRVVMLVIFGHCPLYGYISNVQEY
DLDKNTWSILHTQGALVQGGYGHSSVYDHRTRALYVHGGYKAFSANKYRLADDLYRYDVD
TQMWTILKDSRFFRYLHTAVIVSGTMLVFGGNTHNDTSMSHGAKCFSSDFMAYDIACDRW
SVLPRPDLHHDVNRFGHSAVLHNSTMYVFGGFNSLLLSDILVFTSEQCDAHRSEAACLAA
GPGIRCVWNTGSSQCISWALATDEQEEKLKSECFSKRTLDHDRCDQHTDCYSCTANTNDC
HWCNDHCVPRNHSCSEGQISIFRYENCPKDNPMYYCNKKTSCRSCALDQNCQWEPRNQEC
IALPENICGIGWHLVGNSCLKITTAKENYDNAKLFCRNHNALLASLTTQKKVEFVLKQLR
IMQSSQSMSKLTLTPWVGLRKINVSYWCWEDMSPFTNSLLQWMPSEPSDAGFCGILSEPS
TRGLKAATCINPLNGSVCERPANHSAKQCRTPCALRTACGDCTSGSSECMWCSNMKQCVD
SNAYVASFPFGQCMEWYTMSTCPPENCSGYCTCSHCLEQPGCGWCTDPSNTGKGKCIEGS
YKGPVKMPSQAPTGNFYPQPLLNSSMCLEDSRYNWSFIHCPACQCNGHSKCINQSICEKC
ENLTTGKHCETCISGFYGDPTNGGKCQPCKCNGHASLCNTNTGKCFCTTKGVKGDECQLC
EVENRYQGNPLRGTCYYTLLIDYQFTFSLSQEDDRYYTAINFVATPDEQNRDLDMFINAS
KNFNLNITWAASFSAGTQAGEEMPVVSKTNIKEYKDSFSNEKFDFRNHPNITFFVYVSNF
TWPIKIQIAFSQHSNFMDLVQFFVTFFSCFLSLLLVAAVVWKIKQSCWASRRREQLLREM
QQMASRPFASVNVALETDEEPPDLIGGSIKTVPKPIALEPCFGNKAAVLSVFVRLPRGLG
GIPPPGQSGLAVASALVDISQQMPIVYKEKSGAVRNRKQQPPAQPGTCI
Download sequence
Identical sequences O75882
NP_647537.1.87134 NP_647537.1.92137 ENSP00000262919 NYSGRC-LECT-ENSP00000262919 gi|21450861|ref|NP_647537.1| ENSP00000262919 9606.ENSP00000262919 ENSP00000262919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]