SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000271638 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000271638
Domain Number 1 Region: 7-101
Classification Level Classification E-value
Superfamily EF-hand 1.54e-28
Family S100 proteins 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000271638   Gene: ENSG00000163191   Transcript: ENST00000271638
Sequence length 105
Comment pep:known chromosome:GRCh38:1:152032506:152037035:-1 gene:ENSG00000163191 transcript:ENST00000271638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVL
DRMMKKLDTNSDGQLDFSEFLNLIGGLAMACHDSFLKAVPSQKRT
Download sequence
Identical sequences A0A2K5PJE5 G1RH69 G3R007 H2N5T5 H2Q002 P31949 V9HWH9
9598.ENSPTRP00000002223 9600.ENSPPYP00000000990 9606.ENSP00000271638 ENSGGOP00000008482 ENSPPYP00000000990 ENSP00000271638 ENSNLEP00000012569 ENSPPYP00000000990 gi|5032057|ref|NP_005611.1| ENSNLEP00000012569 ENSP00000271638 ENSPTRP00000002223 ENSPTRP00000002223 2luc_A 2luc_B 001007202|e2lucA1|108.1.1.8|A:1-105 001016350|e2lucB1|108.1.1.8|B:1-105 d2luca_ d2lucb_ NP_005611.1.87134 NP_005611.1.92137 XP_002810252.1.23681 XP_003259306.1.23891 XP_003339045.1.37143 XP_003817270.1.60992 XP_004026717.1.27298 XP_017353626.1.71028 XP_017375585.1.71028 ENSP00000271638 ENSGGOP00000008482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]