SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000272937 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000272937
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 17-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000393
Family HLH, helix-loop-helix DNA-binding domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000272937   Gene: ENSG00000144485   Transcript: ENST00000272937
Sequence length 224
Comment pep:known chromosome:GRCh38:2:238238267:238240124:-1 gene:ENSG00000144485 transcript:ENST00000272937 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAK
LENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VAAELLNHLLESMPLREGSSFQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDD
LCSDLEEAPEAELSQAPAEGPDLVPAALGSLTTAQIARSVWRPW
Download sequence
Identical sequences Q96HZ4
9606.ENSP00000272937 GO.39589 ENSP00000272937 ENSP00000272937 gi|21361763|ref|NP_061115.2| NP_061115.2.87134 NP_061115.2.92137 ENSP00000272937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]