SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000274254 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000274254
Domain Number 1 Region: 157-353
Classification Level Classification E-value
Superfamily RNI-like 4.71e-37
Family Cyclin A/CDK2-associated p19, Skp2 0.00000000592
Further Details:      
 
Domain Number 2 Region: 89-143
Classification Level Classification E-value
Superfamily F-box domain 2.75e-16
Family F-box domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000274254   Gene: ENSG00000145604   Transcript: ENST00000274254
Sequence length 410
Comment pep:known chromosome:GRCh38:5:36151989:36184041:1 gene:ENSG00000145604 transcript:ENST00000274254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLLVTRAG
VRIRLDSDIGCPQTYRTSKLKSSHKLFCQHVRVICIFVCDFYFYRLVLKQ
Download sequence
Identical sequences K7BZX2
ENSP00000274254 NP_116026.1.87134 NP_116026.1.92137 XP_016808911.1.37143 gi|14249170|ref|NP_116026.1| ENSP00000274254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]