SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000275560 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000275560
Domain Number 1 Region: 55-162
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 2 Region: 187-292
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 3 Region: 471-574
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 4 Region: 342-446
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000275560   Gene: ENSG00000146700   Transcript: ENST00000275560
Sequence length 575
Comment pep:known chromosome:GRCh38:7:76389334:76409695:-1 gene:ENSG00000146700 transcript:ENST00000275560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKEAEMLIGPQLDEKRWGWRLGDGSAAPPFLPQALSFLLLLPLASALQPTPLPFQELRL
VGGPSRCRGRLEVMHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPI
LLDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKMLTSRAPPTTL
PNGKSEGSVRLVGGANLCQGRVEILHSGLWGTVCDDDWGLPDAAVVCRQLGCGAAMAATT
NAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGALCAGLGPPTLTALP
SSATREDWAWQTDPSATGVGPQPSRETALLTTAAWAAGKKSGRLRLVGGPGPCRGRVEVL
HAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARL
SDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRVPTPRPRDGHLRLVNGAH
RCEGRVELYLGQRWGTVCDDAWDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNV
KCRGEESALLLCSHIRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences Q8WTU2
9606.ENSP00000275560 NP_542782.1.87134 NP_542782.1.92137 ENSP00000275560 ENSP00000275560 gi|18152779|ref|NP_542782.1| ENSP00000275560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]