SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000278772 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000278772
Domain Number 1 Region: 502-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-23
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 2 Region: 418-474
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-22
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 3 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-22
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 306-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-22
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 543-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-19
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 267-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-18
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 7 Region: 60-103
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-17
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 8 Region: 464-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000102
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000278772   Gene: ENSG00000088876   Transcript: ENST00000278772
Sequence length 599
Comment pep:known chromosome:GRCh38:20:2481817:2509132:-1 gene:ENSG00000088876 transcript:ENST00000278772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLPYPSALGDQYWEEILLPKNGENVETMKKLTQNHKAKGLPSNDTDCPQKKEGKAQIVV
PVTFRDVTVIFTEAEWKRLSPEQRNLYKEVMLENYRNLLSLAEPKPEIYTCSSCLLAFSC
QQFLSQHVLQIFLGLCAENHFHPGNSSPGHWKQQGQQYSHVSCWFENAEGQERGGGSKPW
SARTEERETSRAFPSPLQRQSASPRKGNMVVETEPSSAQRPNPVQLDKGLKELETLRFGA
INCREYEPDHNLESNFITNPRTLLGKKPYICSDCGRSFKDRSTLIRHHRIHSMEKPYVCS
ECGRGFSQKSNLSRHQRTHSEEKPYLCRECGQSFRSKSILNRHQWTHSEEKPYVCSECGR
GFSEKSSFIRHQRTHSGEKPYVCLECGRSFCDKSTLRKHQRIHSGEKPYVCRECGRGFSQ
NSDLIKHQRTHLDEKPYVCRECGRGFCDKSTLIIHERTHSGEKPYVCGECGRGFSRKSLL
LVHQRTHSGEKHYVCRECRRGFSQKSNLIRHQRTHSNEKPYICRECGRGFCDKSTLIVHE
RTHSGEKPYVCSECGRGFSRKSLLLVHQRTHSGEKHYVCRECGRGFSHKSNLIRHQRTH
Download sequence
Identical sequences Q6P1L6
ENSP00000278772 ENSP00000278772 ENSP00000278772 9606.ENSP00000278772 NP_001269424.1.87134 NP_001269424.1.92137 NP_001269425.1.87134 NP_001269425.1.92137 NP_001308729.1.87134 NP_001308729.1.92137 NP_077301.4.87134 NP_077301.4.92137 XP_016883551.1.92137 gi|31563521|ref|NP_077301.4|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]