SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000282641 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000282641
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.25e-24
Family Canonical RBD 0.01
Further Details:      
 
Domain Number 2 Region: 223-326
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.03e-22
Family Canonical RBD 0.0000256
Further Details:      
 
Domain Number 3 Region: 136-223
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-19
Family Canonical RBD 0.000012
Further Details:      
 
Domain Number 4 Region: 442-514
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.000000728
Family Double-stranded RNA-binding domain (dsRBD) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000282641   Gene: ENSG00000148584   Transcript: ENST00000282641
Sequence length 586
Comment pep:known chromosome:GRCh38:10:50799421:50885675:-1 gene:ENSG00000148584 transcript:ENST00000282641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESNHKSGDGLSGTQKEAALRALVQRTGYSLVQENGQRKYGGPPPGWDAAPPERGCEIFI
GKLPRDLFEDELIPLCEKIGKIYEMRMMMDFNGNNRGYAFVTFSNKVEAKNAIKQLNNYE
IRNGRLLGVCASVDNCRLFVGGIPKTKKREEILSEMKKVTEGVVDVIVYPSAADKTKNRG
FAFVEYESHRAAAMARRKLLPGRIQLWGHGIAVDWAEPEVEVDEDTMSSVKILYVRNLML
STSEEMIEKEFNNIKPGAVERVKKIRDYAFVHFSNREDAVEAMKALNGKVLDGSPIEVTL
AKPVDKDSYVRYTRGTGGRGTMLQGEYTYSLGQVYDPTTTYLGAPVFYAPQTYAAIPSLH
FPATKGHLSNRAIIRAPSVRGAAGVRGLGGRGYLAYTGLGRGYQVKGDKREDKLYDILPG
MELTPMNPVTLKPQGIKLAPQILEEICQKNNWGQPVYQLHSAIGQDQRQLFLYKITIPAL
ASQNPAIHPFTPPKLSAFVDEAKTYAAEYTLQTLGIPTDGGDGTMATAAAAATAFPGYAV
PNATAPVSAAQLKQAVTLGQDLAAYTTYEVYPTFAVTARGDGYGTF
Download sequence
Identical sequences A0A024QZJ5
ENSP00000363109 ENSP00000363113 NP_001185747.1.87134 NP_001185747.1.92137 NP_055391.2.87134 NP_055391.2.92137 XP_016871649.1.92137 gi|20357572|ref|NP_055391.2| gi|311771764|ref|NP_001185747.1| ENSP00000282641 ENSP00000363109 ENSP00000363113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]