SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000286091 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000286091
Domain Number 1 Region: 172-285
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.34e-36
Family PDI-like 0.001
Further Details:      
 
Domain Number 2 Region: 490-636
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.4e-36
Family PDI-like 0.00075
Further Details:      
 
Domain Number 3 Region: 59-167
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.77e-35
Family PDI-like 0.0031
Further Details:      
 
Domain Number 4 Region: 287-395
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.01e-21
Family Calsequestrin 0.037
Further Details:      
 
Domain Number 5 Region: 402-524
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000254
Family PDI-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000286091   Gene: ENSG00000155660   Transcript: ENST00000286091
Sequence length 645
Comment pep:known chromosome:GRCh38:7:149003062:149028641:-1 gene:ENSG00000155660 transcript:ENST00000286091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPRKAFLLLLLLGLVQLLAVAGAEGPDEDSSNRENAIEDEEEEEEEDDDEEEDDLEVKE
ENGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKI
DATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTL
VLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAE
TDLAKRFDVSGYPTLKIFRKGRPYDYNGPREKYGIVDYMIEQSGPPSKEILTLKQVQEFL
KDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQGQLVVMQP
EKFQSKYEPRSHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRSKVLEVAKDFPEYTFAIADEEDYAGEVKDLGLSESGEDVNAAILD
ESGKKFAMEPEEFDSDTLREFVTAFKKGKLKPVIKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPSDRYKVEGF
PTIYFAPSGDKKNPVKFEGGDRDLEHLSKFIEEHATKLSRTKEEL
Download sequence
Identical sequences A0A090N8Y2 P13667
gi|4758304|ref|NP_004902.1| ENSP00000286091 9606.ENSP00000286091 ENSP00000286091 ENSP00000286091 hsi002003420.1 NP_004902.1.87134 NP_004902.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]