SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000290399 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000290399
Domain Number 1 Region: 230-334
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.89e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 88-191
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000038
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.054
Further Details:      
 
Domain Number 3 Region: 6-52
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000105
Family HLH, helix-loop-helix DNA-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000290399   Gene: ENSG00000159263   Transcript: ENST00000290399
Sequence length 667
Comment pep:known chromosome:GRCh38:21:36699134:36749917:1 gene:ENSG00000159263 transcript:ENST00000290399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKEKSKNAAKTRREKENGEFYELAKLLPLPSAITSQLDKASIIRLTTSYLKMRAVFPEGL
GDAWGQPSRAGPLDGVAKELGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIYEYIHPSDHDEMTAVLTAHQPLHHHLLQEYEIERSFFLRMKCVLAKRNAGLTCSGY
KVIHCSGYLKIRQYMLDMSLYDSCYQIVGLVAVGQSLPPSAITEIKLYSNMFMFRASLDL
KLIFLDSRVTEVTGYEPQDLIEKTLYHHVHGCDVFHLRYAHHLLLVKGQVTTKYYRLLSK
RGGWVWVQSYATVVHNSRSSRPHCIVSVNYVLTEIEYKELQLSLEQVSTAKSQDSWRTAL
STSQETRKLVKPKNTKMKTKLRTNPYPPQQYSSFQMDKLECGQLGNWRASPPASAAAPPE
LQPHSESSDLLYTPSYSLPFSYHYGHFPLDSHVFSSKKPMLPAKFGQPQGSPCEVARFFL
STLPASGECQWHYANPLVPSSSSPAKNPPEPPANTARHSLVPSYEAPAAAVRRFGEDTAP
PSFPSCGHYREEPALGPAKAARQAARDGARLALARAAPECCAPPTPEAPGAPAQLPFVLL
NYHRVLARRGPLGGAAPAASGLACAPGGPEAATGALRLRHPSPAATSPPGAPLPHYLGAS
VIITNGR
Download sequence
Identical sequences Q14190
ENSP00000290399 ENSP00000290399 9606.ENSP00000290399 NP_005060.1.87134 NP_005060.1.92137 ENSP00000290399 gi|4827004|ref|NP_005060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]