SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000294119 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000294119
Domain Number 1 Region: 153-284
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.75e-22
Family UBX domain 0.015
Further Details:      
 
Domain Number 2 Region: 6-54
Classification Level Classification E-value
Superfamily UBA-like 8.62e-17
Family UBA domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000294119   Gene: ENSG00000162191   Transcript: ENST00000294119
Sequence length 312
Comment pep:known chromosome:GRCh38:11:62676498:62679055:-1 gene:ENSG00000162191 transcript:ENST00000294119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTALESLIEMGFPRGRAEKALALTGNQGIEAAMDWLMEHEDDPDVDEPLETPLGHIL
GREPTSSEQGGLEGSGSAAGEGKPALSEEERQEQTKRMLELVAQKQREREEREEREALER
ERQRRRQGQELSAARQRLQEDEMRRAAEERRREKAEELAARQRVREKIERDKAERAKKYG
GSVGSQPPPVAPEPGPVPSSPSQEPPTKREYDQCRIQVRLPDGTSLTQTFRAREQLAAVR
LYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGMAARLETRTRNWGSREAC
LGKGGMQREGAL
Download sequence
Identical sequences A0A024R539
gi|21361517|ref|NP_056937.2| ENSP00000294119 ENSP00000294119 NP_056937.2.87134 NP_056937.2.92137 XP_005274090.1.92137 ENSP00000303991 9606.ENSP00000294119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]