SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000296096 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000296096
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000942
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000296096   Gene: ENSG00000163792   Transcript: ENST00000296096
Sequence length 214
Comment pep:known chromosome:GRCh38:2:27149004:27156974:1 gene:ENSG00000163792 transcript:ENST00000296096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRKARGPPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATP
GPRGTRAGGLALGRSEASPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDAEVGSQVPGEADALLSTTPLSPALGDK
Download sequence
Identical sequences H2QHL7 Q7RTU1
ENSPTRP00000020196 ENSP00000296096 9598.ENSPTRP00000020196 9606.ENSP00000296096 ENSP00000296096 NP_786951.1.87134 NP_786951.1.92137 XP_001154318.1.37143 XP_003827134.1.60992 ENSPTRP00000020196 gi|75677394|ref|NP_786951.1| ENSP00000296096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]