SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000299179 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000299179
Domain Number 1 Region: 25-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.93e-19
Family Mitochondrial ribosomal protein L51/S25/CI-B8 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000299179   Gene: ENSG00000055950   Transcript: ENST00000299179
Sequence length 202
Comment pep:known chromosome:GRCh38:10:100981376:100987494:-1 gene:ENSG00000055950 transcript:ENST00000299179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPISVQ
SSDLPWGNTHYRPEPLSSTTWL
Download sequence
Identical sequences A0A2J8PDA2
gi|28872736|ref|NP_789763.1| ENSP00000299179 NP_789763.1.87134 NP_789763.1.92137 ENSP00000299179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]