SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000310472 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000310472
Domain Number 1 Region: 648-705
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 481-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 49-109
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.27e-25
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 4 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.93e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 704-761
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.7e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 7 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 8 Region: 760-817
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.24e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.48e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 10 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 11 Region: 806-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 12 Region: 274-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.53e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000310472   Gene: ENSG00000197566   Transcript: ENST00000311331
Sequence length 865
Comment pep:known chromosome:GRCh38:17:16620737:16653853:-1 gene:ENSG00000197566 transcript:ENST00000311331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLQDSTLSREGKPEGEIMAAVFFSVGRLSPEVTQPDEDLHLQAEETQLVKESVTFKDVA
IDFTLEEWRLMDPTQRNLHKDVMLENYRNLVSLGLAVSKPDMISHLENGKGPWVTVREIS
RIPYPDMEPKPATKKATRTKAISEDLSQEAILEKLTENGLWDSRMEGLWKWNDRILRLQN
NQENHLSQRIIPLKKTPTSQRGFRFESILIPEPGIATEELHSRCQTQEENFTENLNLITD
THLGKIICKEMKGSKAIRQTSELTLGKKSNNKEKPYKCSTCEKAFHYRSLLIQHQRTHTK
EKPYECNECGKTFSQPSYLSQHKKIHTGEKPYKCNECGKAFIASSSLMVHQRIHTKEKPY
QCNVCGKSFSQCARLNQHQRIQTGEKPYKCSECGKAFSDKSKLARHQETHNGEKPYKCDD
CGKAFRNKSYLSVHQKTHTEEKPYQCNECGKSFKNTTIFNVHQRIHTGEKPFRCNECGKA
YRSNSSLIVHIRTHTGEKPYECNECGKAFNRIANFTEHQRIHTGEKPYKCNECGKAFINY
SCLTVHHRMHTGEKPYKCTECGKAFMRSSSLIIHQRIHTEEKPYLCNECGESFRIKSHLT
VHQRIHTGEKPYKCTDCERAFTKMVNLKEHQKIHTGVKPYKCYDCGKSFRTKSYLIVHQR
THTGEKPYKCNECEKAFTNTSQLTVHQRRHTGEKPYKCNECGKVFTSNSGFNTHQRTHTG
EKPFKCNDCGKAFSQMVHVTEHQKIHSGEKPYKCDVCGKAFRRGSYLTVHWRTHTGEKPY
TCKECGKGCITLSQLTLHQRIHTGERPYKCEECGKAFRTNSDFTVHLRMHTGEKPYKCNE
CGKAFRSSSSLTVHQRIHQRETQLI
Download sequence
Identical sequences Q9P2J8
9606.ENSP00000310472 ENSP00000310472 NP_065838.2.87134 NP_065838.2.92137 XP_006721625.1.92137 ENSP00000310472 ENSP00000310472 gi|172072608|ref|NP_065838.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]