SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000312059 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000312059
Domain Number 1 Region: 15-129
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.57e-31
Family Pyk2-associated protein beta ARF-GAP domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000312059   Gene: ENSG00000173744   Transcript: ENST00000310078
Sequence length 562
Comment pep:known chromosome:GRCh38:2:227472162:227561214:1 gene:ENSG00000173744 transcript:ENST00000310078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASAKRKQEEKHLKMLRDMTGLPHNRKCFDCDQRGPTYVNMTVGSFVCTSCSGSLRGLN
PPHRVKSISMTTFTQQEIEFLQKHGNEVCKQIWLGLFDDRSSAIPDFRDPQKVKEFLQEK
YEKKRWYVPPEQAKVVASVHASISGSSASSTSSTPEVKPLKSLLGDSAPTLHLNKGTPSQ
SPVVGRSQGQQQEKKQFDLLSDLGSDIFAAPAPQSTATANFANFAHFNSHAAQNSANADF
ANFDAFGQSSGSSNFGGFPTASHSPFQPQTTGGSAASVNANFAHFDNFPKSSSADFGTFN
TSQSHQTASAVSKVSTNKAGLQTADKYAALANLDNIFSAGQGGDQGSGFGTTGKAPVGSV
VSVPSQSSASSDKYAALAELDSVFSSAATSSNAYTSTSNASSNVFGTVPVVASAQTQPAS
SSVPAPFGATPSTNPFVAAAGPSVASSTNPFQTNARGATAATFGTASMSMPTGFGTPAPY
SLPTSFSGSFQQPAFPAQAAFPQQTAFSQQPNGAGFAAFGQTKPVVTPFGQVAAAGVSSN
PFMTGAPTGQFPTGSSSTNPFL
Download sequence
Identical sequences A0A0S2Z444 P52594
ENSP00000312059 gi|38570132|ref|NP_004495.2| NP_004495.2.87134 NP_004495.2.92137 ENSP00000312059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]