SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000316320 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000316320
Domain Number 1 Region: 191-321
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.1e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000166
Further Details:      
 
Domain Number 2 Region: 60-198
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.9e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000301
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000316320   Gene: ENSG00000156709   Transcript: ENST00000346424
Sequence length 326
Comment pep:novel chromosome:GRCh38:X:130129362:130165680:-1 gene:ENSG00000156709 transcript:ENST00000346424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPARALGTEVIQLFPEKGNMGKILPEY
LSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELA
KTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGE
NMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTG
IRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPI
ARKIIKDGEQHEDLNEVAKLFNIHED
Download sequence
Identical sequences A0A2J8WWP9
ENSP00000316320 ENSP00000316320 gi|22202631|ref|NP_665812.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]