SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000317580 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000317580
Domain Number 1 Region: 90-155
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000317580   Gene: ENSG00000181965   Transcript: ENST00000314744
Sequence length 237
Comment pep:known chromosome:GRCh38:5:135534282:135535949:-1 gene:ENSG00000181965 transcript:ENST00000314744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARLETCISDLDCASSSGSDLSGFLTDEEDCARLQQAASASGPPAPARRGAPNISRASE
VPGAQDDEQERRRRRGRTRVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVLP
SFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGGARERLLPPQCVPCLPGPPSPA
SDAESWGSGAAAASPLSDPSSPAASEDFTYRPGDPVFSFPSLPKDLLHTTPCFIPYH
Download sequence
Identical sequences F1T0H3 Q92886
ENSP00000317580 ENSP00000317580 9606.ENSP00000317580 NP_006152.2.87134 NP_006152.2.92137 gi|38455396|ref|NP_006152.2| HR6466 ENSP00000317580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]