SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000318607 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000318607
Domain Number 1 Region: 29-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000223
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 70-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 110-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000318607   Gene: ENSG00000179241   Transcript: ENST00000315571
Sequence length 345
Comment pep:known chromosome:GRCh38:11:35944078:36232136:1 gene:ENSG00000179241 transcript:ENST00000315571 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLGPLCLLLSSAAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSD
EKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFEDCPDGSDEENCTANPLLCSTARYHC
KNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGSGQVFVTSENQLVYYPSITYAIIGSS
VIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPVLLSRLVVLDHPHHCNVTYNVNNGIQ
YVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPPPPYSSDTESLNQADLPPYRSRSGSA
NSASSQAASSLLSVEDTSHSPGQPGPQEGTAEPRDSEPSQGTEEV
Download sequence
Identical sequences A0A2K6CYQ8 G1S8F3 H2NDP5 H2Q3F1 Q86YD5
NP_777562.1.87134 NP_777562.1.92137 XP_001142392.2.37143 XP_011722407.1.29376 ENSP00000318607 gi|28557796|ref|NP_777562.1| ENSPPYP00000003850 ENSPPYP00000003850 ENSNLEP00000021792 ENSP00000318607 ENSPTRP00000006091 ENSNLEP00000021792 ENSPTRP00000006091 ENSP00000318607 9598.ENSPTRP00000006091 9600.ENSPPYP00000003850 9606.ENSP00000318607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]