SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000320217 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000320217
Domain Number 1 Region: 411-541
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000804
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000320217   Gene: ENSG00000135502   Transcript: ENST00000320442
Sequence length 563
Comment pep:known chromosome:GRCh38:12:57619910:57626131:1 gene:ENSG00000135502 transcript:ENST00000320442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASVPPVFGLYTSF
FPVLIYSLLGTGRHLSTGTFAILSLMTGSAVERLVPEPLVGNLSGIEKEQLDAQRVGVAA
AVAFGSGALMLGMFVLQLGVLSTFLSEPVVKALTSGAALHVLLSQLPSLLGLSLPRQIGC
FSLFKTLASLLTALPRSSPAELTISALSLALLVPVKELNVRFRDRLPTPIPGEVVLVLLA
SVLCFTSSVDTRYQVQIVGLLPGGFPQPLLPNLAELPRILADSLPIALVSFAVSASLASI
HADKYSYTIDSNQEFLAHGASNLISSLFSCFPNSATLATTNLLVDAGGKTQLAGLFSCTV
VLSVLLWLGPFFYYLPKAVLACINISSMRQVFCQMQELPQLWHISRVDFLLQVPGLCILS
YPTPLYFGTRGQFRCNLEWHLGLGEGEKETSKPDGPMVAVAEPVRVVVLDFSGVTFADAA
GAREVVQVRERLASRCRDARIRLLLAQCNALVQGTLTRVGLLDRVTPDQLFVSVQDAAAY
ALGSLLRGSSTRSGSQEALGCGK
Download sequence
Identical sequences Q8NG04
ENSP00000320217 9606.ENSP00000257962 gi|65506789|ref|NP_597996.2| ENSP00000320217 NP_597996.2.87134 NP_597996.2.92137 ENSP00000320217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]