SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000321049 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000321049
Domain Number 1 Region: 529-585
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.39e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 641-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 585-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 361-417
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 473-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.68e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 417-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 697-753
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.24e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 9 Region: 738-790
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.57e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 318-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 278-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000378
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 224-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000365
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000321049   Gene: ENSG00000131115   Transcript: ENST00000313040
Sequence length 799
Comment pep:known chromosome:GRCh38:19:44212538:44237268:1 gene:ENSG00000131115 transcript:ENST00000313040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQNYDLPQKKQEKMTKFQEAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLV
AVGHLPFQPDMVSQLEAEEKLWMMETETQRSSKHQNKMETLQKFALKYLSNQELSCWQIW
KQVASELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGDSSIYIENQEFPFWRTQHSCGN
TYLSESQIQSRGKQIDVKNNLQIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGSN
QKLPLGEKPHPCGECGRGFSYSPRLPLHPNVHTGEKCFSQSSHLRTHQRIHPGEKLNRCH
ESGDCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEKPYKCEECGKC
FSQSSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQA
AHFHIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLH
IHFRVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQR
VHTGEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSG
EKPYKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPY
KCDVCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHICEE
CGKAFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLEAHQRVHTGEKPYKCDICDKD
FRHRSRLTYHQKVHTGKKL
Download sequence
Identical sequences Q86WZ6
ENSP00000321049 ENSP00000321049 9606.ENSP00000321049 NP_001276095.1.87134 NP_001276095.1.92137 NP_872296.1.87134 NP_872296.1.92137 XP_005259289.1.92137 XP_011525591.1.92137 XP_016882755.1.92137 gi|32698786|ref|NP_872296.1| ENSP00000321049 ENSP00000482749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]