SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000325917 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000325917
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 1.57e-88
Family Subtilases 0.0000000252
Further Details:      
 
Domain Number 2 Region: 474-615
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.5e-36
Family Proprotein convertase P-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000116
Family Prohormone convertase 1 pro-domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000325917   Gene: ENSG00000160613   Transcript: ENST00000320934
Sequence length 785
Comment pep:known chromosome:GRCh38:11:117204337:117232525:-1 gene:ENSG00000160613 transcript:ENST00000320934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHLDAPLGLPTCLWLELAGLFLLVPWVMGLAGTGGPDGQGTGGPSWAVHLES
LEGDGEEETLEQQADALAQAAGLVNAGRIGELQGHYLFVQPAGHRPALEVEAIRQQVEAV
LAGHEAVRWHSEQRLLRRAKRSVHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATRYEDRRAEWVTNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKENKAIPQSPRSLEVLWNVSRMDLEMSGLKTLEHVAVTVSITHPRRG
SLELKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDESF
QVGILRQWQLTLYGSVWSAVDIRDRQRLLESAMSGKYLHDDFALPCPPGLKIPEEDGYTI
TPNTLKTLVLVGCFTVFWTVYYMLEVYLSQRNVASNQVCRSGPCHWPHRSRKAKEEGTEL
ESVPLCSSKDPDEVETESRGPPTTSDLLAPDLLEQGDWSLSQNKSALDCPHQHLDVPHGK
EEQIC
Download sequence
Identical sequences Q16549
ENSP00000325917 gi|20336248|ref|NP_004707.2| NP_004707.2.87134 NP_004707.2.92137 ENSP00000325917 ENSP00000325917 9606.ENSP00000325917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]