SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000331081 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000331081
Domain Number 1 Region: 167-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000208
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 131-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000803
Family EGF-type module 0.014
Further Details:      
 
Domain Number 3 Region: 88-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000277
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSP00000331081
Domain Number - Region: 210-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 65-87
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.073
Further Details:      
 
Domain Number - Region: 33-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0954
Family EGF-type module 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000331081   Gene: ENSG00000185559   Transcript: ENST00000331224
Sequence length 310
Comment pep:known chromosome:GRCh38:14:100726909:100735127:1 gene:ENSG00000185559 transcript:ENST00000331224 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTATEALLRVLLLLLAFGHSTYGAECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTS
PGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNRTCVSLDDGLYECSCAPGYS
GKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCE
NDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQGQAICFTILGVL
TSLVVLGTVGIVFLNKCETWVSNLRYNHMLRKKKNLLLQYNSGEDLAVNIIFPEKIDMTT
FSKEAGDEEI
Download sequence
Identical sequences ENSP00000331081 ENSP00000331081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]