SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000331152 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000331152
Domain Number 1 Region: 131-215
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000127
Family HLH, helix-loop-helix DNA-binding domain 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000331152   Gene: ENSG00000119950   Transcript: ENST00000332674
Sequence length 295
Comment pep:known chromosome:GRCh38:10:110207605:110287365:1 gene:ENSG00000119950 transcript:ENST00000332674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRGRPRKEARCEGAGLAPAAPPAVPPAVAAPQPPALPEDPAGAKPRCPFSDIFNTSEN
SMEKHINTFLQNVQILLEAASYLEQIEKENKKCEHGYASSFPSMPSPRLQHSKPPRRLSR
AQKHSSGSSNTSTANRSTHNELEKNRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAK
AHIKKLEEAERKSQHQLENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSE
REEIEVDVESTEFSHGEVDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences gi|47717116|ref|NP_569157.2| NP_569157.2.87134 NP_569157.2.92137 ENSP00000331152 9606.ENSP00000331152 ENSP00000331152 ENSP00000239007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]