SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000332223 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332223
Domain Number 1 Region: 180-332
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000106
Family Growth factor receptor domain 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSP00000332223
Domain Number - Region: 146-179
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0391
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332223   Gene: ENSG00000184164   Transcript: ENST00000328268
Sequence length 353
Comment pep:known chromosome:GRCh38:22:49918696:49927528:1 gene:ENSG00000184164 transcript:ENST00000328268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAW
EEKTLSKYESSEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFC
VKTLKVCCSPGTYGPDCLACQGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDC
MDGYFSSLRNETHSICTACDESCKTCSGLTNRDCGECEVGWVLDEGACVDVDECAAEPPP
CSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISGYAREHGQCADVDECSLAEKT
CVRKNENCYNTPGSYVCVCPDGFEETEDACVPPAEAEATEGESPTQLPSREDL
Download sequence
Identical sequences Q6UXH1
NP_077300.3.87134 NP_077300.3.92137 gi|205360958|ref|NP_077300.3| ENSP00000332223 ENSP00000332223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]