SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332293 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332293
Domain Number 1 Region: 54-130
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 5.5e-18
Family HLH, helix-loop-helix DNA-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332293   Gene: ENSG00000183734   Transcript: ENST00000331289
Sequence length 193
Comment pep:known chromosome:GRCh38:11:2268495:2270952:-1 gene:ENSG00000183734 transcript:ENST00000331289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERER
NRVKLVNLGFQALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGL
RPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAE
RELLDFSSWLGGY
Download sequence
Identical sequences Q99929
NP_005161.1.87134 NP_005161.1.92137 ENSP00000332293 ENSP00000332293 ENSP00000332293 HR4510 gi|4885665|ref|NP_005161.1| 9606.ENSP00000332293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]