SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000332750 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000332750
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.15e-35
Family SCAN domain 0.0000652
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 514-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 214-270
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000116
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000332750   Gene: ENSG00000198315   Transcript: ENST00000330236
Sequence length 578
Comment pep:known chromosome:GRCh38:6:28141938:28159472:1 gene:ENSG00000198315 transcript:ENST00000330236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEESRKPSAPSPPDQTPEEDLVIVKVEEDHGWDQESSLHESNPLGQEVFRLRFRQLRYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPEELQTLVKEHQLENGE
EVVTLLEDLERQIDILGRPVSARVHGHRVLWEEVVHSASAPEPPNTQLQSEATQHKSPVP
QESQERAMSTSQSPTRSQKGSSGDQEMTATLLTAGFQTLEKIEDMAVSLIREEWLLDPSQ
KDLCRDNRPENFRNMFSLGGETRSENRELASKQVISTGIQPHGETAAKCNGDVIRGLEHE
EARDLLGRLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFS
YRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGH
QRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIH
TGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESISV
Download sequence
Identical sequences A0A024RCK7 Q15776
9606.ENSP00000332750 ENSP00000332750 ENSP00000402948 NP_001265048.1.87134 NP_001265048.1.92137 NP_006289.2.87134 NP_006289.2.92137 XP_011513172.1.92137 XP_016866755.1.92137 ENSP00000332750 gi|56699473|ref|NP_006289.2| ENSP00000332750 ENSP00000402948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]