SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000334805 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000334805
Domain Number - Region: 59-124
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0326
Family Linker histone H1/H5 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000334805   Gene: ENSG00000187166   Transcript: ENST00000335017
Sequence length 255
Comment pep:known chromosome:GRCh38:12:48328980:48330279:1 gene:ENSG00000187166 transcript:ENST00000335017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRV
SQLVLQAISTHKGLTLAALKKELRNAGYEVRRKSGRHEAPRGQAKATLLRVSGSDAAGYF
RVWKVPKPRRKPGRARQEEGTRAPWRTPAAPRSSRRRRQPLRKAARKAREVWRRNARAKA
KANARARRTRRARPRAKEPPCARAKEEAGATAADEGRGQAVKEDTTPRSGKDKRRSSKPR
EEKQEPKKPAQRTIQ
Download sequence
Identical sequences A0A140VK96 Q75WM6
NP_861453.1.87134 NP_861453.1.92137 gi|32401437|ref|NP_861453.1| 9606.ENSP00000334805 ENSP00000334805 ENSP00000334805 ENSP00000334805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]