SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000338034 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000338034
Domain Number 1 Region: 30-202
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.07e-38
Family SPRY domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000338034   Gene: ENSG00000176422   Transcript: ENST00000338146
Sequence length 207
Comment pep:known chromosome:GRCh38:12:56468567:56479707:1 gene:ENSG00000176422 transcript:ENST00000338146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFARSLRLCRWGAKRLGVASTEAQRGVSFKLEEKTAHSSLALFRDDTGVKYGLVGLE
PTKVALNVERFREWAVVLADTAVTSGRHYWEVTVKRSQQFRIGVADVDMSRDSCIGVDDR
SWVFTYAQRKWYTMLANEKAPVEGIGQPEKVGLLLEYEAQKLSLVDVSQVSVVHTLQTDF
RGPVVPAFALWDGELLTHSGLEVPEGL
Download sequence
Identical sequences G3RKA5 H2NHQ5 H2Q691
9598.ENSPTRP00000008678 9600.ENSPPYP00000005313 gi|46409324|ref|NP_997227.1| ENSPTRP00000008678 ENSPPYP00000005313 ENSPTRP00000008678 NP_997227.1.87134 NP_997227.1.92137 XP_001168831.1.37143 XP_002823448.1.23681 XP_004053429.1.27298 ENSP00000338034 HR6583 ENSPPYP00000005313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]