SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000339087 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSP00000339087
Domain Number - Region: 43-136
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0785
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000339087   Gene: ENSG00000176714   Transcript: ENST00000324364
Sequence length 278
Comment pep:known chromosome:GRCh38:2:27625639:27629012:-1 gene:ENSG00000176714 transcript:ENST00000324364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDLNKHIKQAQTQRKQLLEESRELHREKLLVQAENRFFLEYLTNKTEEYTEQPEKVWNS
YLQKSGEIERRRQESASRYAEQISVLKTALLQKENIQSSLKRKLQAMRDIAILKEKQEKE
IQTLQEETKKVQAETASKTREVQAQLLQEKRLLEKQLSEPDRRLLGKRKRRELNMKAQAL
KLAAKRFIFEYSCGINRENQQFKKELLQLIEQAQKLTATQSHLENRKQQLQQEQWYLESL
IQARQRLQGSHNQCLNRQDVPKTTPSLPQGTKSRINPK
Download sequence
Identical sequences Q6ZUS5
NP_078860.2.87134 NP_078860.2.92137 gi|39979626|ref|NP_078860.2| ENSP00000339087 GO.55802 ENSP00000339087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]