SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343617 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343617
Domain Number 1 Region: 464-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 57-118
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.15e-26
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 520-577
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.3e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 688-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 408-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 576-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 634-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 730-782
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.88e-18
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 9 Region: 355-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000136
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 10 Region: 297-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000417
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343617   Gene: ENSG00000166704   Transcript: ENST00000341164
Sequence length 792
Comment pep:known chromosome:GRCh38:19:57977053:58003349:-1 gene:ENSG00000166704 transcript:ENST00000341164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAINPWASWGALTDQSWGMTAVDPWASWALCPQYPAWHVEGSLEEGRRATGLPAAQVQE
PVTFKDVAVDFTQEEWGQLDLVQRTLYRDVMLETYGHLLSVGNQIAKPEVISLLEQGEEP
WSVEQACPQRTCPEWVRNLESKALIPAQSIFEEEQSHGMKLERYIWDDPWFSRLEVLGCK
DQLEMYHMNQSTAMRQMVFMQKQVLSQRSSEFCGLGAEFSQNLNFVPSQRVSQIEHFYKP
DTHAQSWRCDSAIMYADKVTCENNDYDKTVYQSIQPIYPARIQTGDNLFKCTDAVKSFNH
IIHFGDHKGIHTGEKLYEYKECHQIFNQSPSFNEHPRLHVGENQYNYKEYENIFYFSSFM
EHQKIGTVEKAYKYNEWEKVFGYDSFLTQHTSTYTAEKPYDYNECGTSFIWSSYLIQHKK
THTGEKPYECDKCGKVFRNRSALTKHERTHTGIKPYECNKCGKAFSWNSHLIVHKRIHTG
EKPYVCNECGKSFNWNSHLIGHQRTHTGEKPFECTECGKSFSWSSHLIAHMRMHTGEKPF
KCDECEKAFRDYSALSKHERTHSGAKPYKCTECGKSFSWSSHLIAHQRTHTGEKPYNCQE
CGKAFRERSALTKHEIIHSGIKPYECNKCGKSCSQMAHLVRHQRTHTGEKPYECNKCGKS
FSQSCHLVAHRRIHTGEKPYKCNQCERSFNCSSHLIAHRRTHTGEKPYRCNECGKAFNES
SSLIVHLRNHTGEKPYKCNHCEKAFCKNSSLIIHQRMHSGEKRFICSECGKAFSGHSALL
QHQRNHSEEKLN
Download sequence
Identical sequences A0A024R4S7 Q8WXB4
ENSP00000343617 ENSP00000343617 9606.ENSP00000343617 ENSP00000343617 NP_079303.2.87134 NP_079303.2.92137 XP_005259333.1.92137 gi|31377839|ref|NP_079303.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]