SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000343948 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000343948
Domain Number 1 Region: 315-384
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000471
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSP00000343948
Domain Number - Region: 375-463
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 0.0513
Family NADH oxidase/flavin reductase 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000343948   Gene: ENSG00000112561   Transcript: ENST00000343317
Sequence length 562
Comment pep:putative chromosome:GRCh38:6:41683978:41691476:-1 gene:ENSG00000112561 transcript:ENST00000343317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEEDRTFSFGPGTRKLGFMSQLSPACSVTLGKSLPLSGLGVFSSKMDAVPVILASPCQP
LCFEEDTCLIYLLPLLIHREPAPAATMASRIGLRMQLMREQAQQEEQRERMQQQAVMHYM
QQQQQQQQQQLGGPPTPAINTPVHFQSPPPVPGEVLKVQSYLENPTSYHLQQSQHQKVRE
YLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPNSPMAMLHIGSNPE
RELDDVIDNIMRLDDVLGYINPEMQMPNTLPLSSSHLNVYSSDPQVTASLVGVTSSSCPA
DLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNINDRIKELGMLIPKANDLDVRWNK
GTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQELEMQARVHGLPTTSPS
GMNMAELAQQVVKQELPSEEGPGEALMLGAEVPDPEPLPALPPQAPLPLPTQPPSPFHHL
DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLPLASDPLLSTM
SPEASKASSRRSSFSMEEGDVL
Download sequence
Identical sequences B0QYS7
ENSP00000362124 ENSP00000343948 ENSP00000343948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]