SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345140 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345140
Domain Number 1 Region: 532-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 106-151
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000942
Family KRAB domain (Kruppel-associated box) 0.0048
Further Details:      
 
Domain Number 3 Region: 511-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000126
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 434-473
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000147
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSP00000345140
Domain Number - Region: 17-89
Classification Level Classification E-value
Superfamily Tropomyosin 0.0425
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345140   Gene: ENSG00000181220   Transcript: ENST00000340622
Sequence length 644
Comment pep:known chromosome:GRCh38:7:149472794:149497817:-1 gene:ENSG00000181220 transcript:ENST00000340622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAVAAPISPWTMAATIQAMERKIESQAARLLSLEGRTGMAEKKLADCEKTAVEFGNQL
EGKWAVLGTLLQEYGLLQRRLENVENLLRNRNFWILRLPPGSKGESPKEWGKLEDWQKEL
YKHVMRGNYETLVSLDYAISKPEVLSQIEQGKEPCNWRRPGPKIPDVPVDPSPGSGPPVP
APDLLMQIKQEGELQLQEQQALGVEAWAAGQPDIGEEPWGLSQLDSGAGDISTDATSGVH
SNFSTTIPPTSWQTDLPPHHPSSACSDGTLKLNTAASTEDVKIVIKTEVQEEEVVATPVH
PTDLEAHGTLFGPGQATRFFPSPAQEGAWESQGSSFPSQDPVLGLREPARPERDMGELSP
AVAQEETPPGDWLFGGVRWGWNFRCKPPVGLNPRTGPEGLPYSSPDNGEAILDPSQAPRP
FNEPCKYPGRTKGFGHKPGLKKHPAAPPGGRPFTCATCGKSFQLQVSLSAHQRSCGAPDG
SGPGTGGGGSGSGGGGGGSGGGSARDGSALRCGECGRCFTRPAHLIRHRMLHTGERPFPC
TECEKRFTERSKLIDHYRTHTGVRPFTCTVCGKSFIRKDHLRKHQRNHAAGAKTPARGQP
LPTPPAPPDPFKSPASKGPLASTDLVTDWTCGLSVLGPTDGGDM
Download sequence
Identical sequences Q6NUN9
gi|46358366|ref|NP_689770.3| 9606.ENSP00000345140 NP_689770.3.87134 NP_689770.3.92137 ENSP00000345140 ENSP00000345140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]