SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSP00000345229 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345229
Domain Number 1 Region: 379-510
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000173
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 493-618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000659
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 349-391
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000779
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 4 Region: 95-135
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 5 Region: 46-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000013
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSP00000345229
Domain Number - Region: 318-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000103
Family EGF-type module 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345229   Gene: ENSG00000187957   Transcript: ENST00000341772
Sequence length 737
Comment pep:known chromosome:GRCh38:2:229357629:229714558:-1 gene:ENSG00000187957 transcript:ENST00000341772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCT
SRPEPDPQHPAPAGEPGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYL
CICNEGYEGPNCEQALPSLPATGWTESMAPRQLQPVPATQEPDKILPRSQATVTLPTWQP
KTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTSVKIRQDATASLILLW
KVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQN
NASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPE
GYFGSACEEKVDPCASSPCQNNGTCYVDGVHFTCNCSPGFTGPTCAQLIDFCALSPCAHG
TCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVNGYECVCLAEYKGTHC
ELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVG
ICRISRIEYQGSSRPAYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYED
YSPDDKPLVTLIKTKDL
Download sequence
Identical sequences Q8NFT8
ENSP00000345229 gi|116235485|ref|NP_620711.3| ENSP00000345229 9606.ENSP00000345229 NP_620711.3.87134 NP_620711.3.92137 ENSP00000345229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]