SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345425 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345425
Domain Number 1 Region: 197-304
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 2.99e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.00014
Further Details:      
 
Domain Number 2 Region: 99-177
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 1.19e-18
Family Double-stranded RNA-binding domain (dsRBD) 0.00037
Further Details:      
 
Domain Number 3 Region: 23-96
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0000000000154
Family Double-stranded RNA-binding domain (dsRBD) 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSP00000345425
Domain Number - Region: 405-474
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00165
Family Double-stranded RNA-binding domain (dsRBD) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345425   Gene: ENSG00000124214   Transcript: ENST00000340954
Sequence length 496
Comment pep:known chromosome:GRCh38:20:49113523:49188367:-1 gene:ENSG00000124214 transcript:ENST00000340954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNGK
GKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVN
FEVARESGPPHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERV
KPRIKKKTKPIVKPQTSPEYGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVM
QVKVGNHTAEGTGTNKKVAKRNAAENMLEILGFKVPQAQPTKPALKSEEKTPIKKPGDGR
KVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPMVPEVAQAVGVSQGHHTKDFTR
AAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPSEQLDYLSRVQG
FQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQST
EMPRTGNGPMSVCGRC
Download sequence
Identical sequences NP_004593.2.87134 NP_004593.2.92137 NP_059346.2.87134 NP_059346.2.92137 NP_059348.2.87134 NP_059348.2.92137 ENSP00000323443 ENSP00000345425 ENSP00000353604 ENSP00000323443 ENSP00000345425 ENSP00000353604 gi|82659083|ref|NP_004593.2| gi|82659085|ref|NP_059346.2| gi|82659089|ref|NP_059348.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]