SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345809 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345809
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.74e-36
Family SCAN domain 0.0000683
Further Details:      
 
Domain Number 2 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 742-799
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 799-855
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 911-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 518-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 855-911
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.84e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 9 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-268
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.79e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 687-743
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 12 Region: 574-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.56e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 13 Region: 366-416
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.45e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 952-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000106
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345809   Gene: ENSG00000186448   Transcript: ENST00000344387
Sequence length 1029
Comment pep:known chromosome:GRCh38:3:44625040:44644220:1 gene:ENSG00000186448 transcript:ENST00000344387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENVAHNALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQLHHPGSGEEAVALVEEL
QKDLDGPAIQVPVLVKDQDTLQKVVSAPGTTLPPVLPGSHIAAEICPHPPTDLVAFNLQD
PQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKPSSSQRADSHKGTSKRLQGSVPQVLDFEEE
CEWQVLASQWGNETDERADTVKKVSLCERDKKKRTPPEKQGQKWKELGDSLTFGSAISES
LIGTEGKKFYKCDMCCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNH
SGEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGER
PYKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKC
DECGKTFAQTTYLIDHQRLHSAENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCG
KIFSSKSNFIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFI
LKKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKS
FMVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSECGRAFSSNRNLIEH
KRIHSGEKPYECDECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIH
TGEKPYACSECGKGFTYNRNLIEHQRIHSGEKTYECHVCRKVLTSSRNLMVHQRIHTGEK
PYKCNECGKDFSQNKNLVVHQRMHTGEKPYECDKCRKSFTSKRNLVGHQRIHTGEKPYGC
NDCSKVFRQRKNLTVHQKIHTDEKPCECDVSEKEFSQTSNLHLQQKIHTIEEFSWLQNTN
ESKIEIQKI
Download sequence
Identical sequences O14709
ENSP00000345809 ENSP00000379370 gi|11386193|ref|NP_008922.1| 9606.ENSP00000345809 ENSP00000345809 ENSP00000379370 ENSP00000373250 NP_008922.1.87134 NP_008922.1.92137 XP_005264840.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]