SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000345900 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000345900
Domain Number 1 Region: 9-170
Classification Level Classification E-value
Superfamily RUN domain-like 3.53e-44
Family RUN domain 0.0011
Further Details:      
 
Domain Number 2 Region: 461-567
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000024
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSP00000345900
Domain Number - Region: 393-514
Classification Level Classification E-value
Superfamily Tropomyosin 0.0163
Family Tropomyosin 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000345900   Gene: ENSG00000188282   Transcript: ENST00000344321
Sequence length 571
Comment pep:known chromosome:GRCh38:2:218070496:218090580:1 gene:ENSG00000188282 transcript:ENST00000344321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEEGAILKVTKDLRAAVSAILQGYGDGQGPVTDTSAELHRLCGCLELLLQFDQKEQKSF
LGPRKDYWDFLCTALRRQRGNMEPIHFVRSQDKLKTPLGKGRAFIRFCLARGQLAEALQL
CLLNSELTREWYGPRSPLLCPERQEDILDSLYALNGVAFELDLQQPDLDGAWPMFSESRC
SSSTQTQGRRPRKNKDAPKKIPAAYGGPENVQIEDSHTSQAICLQDAPSGQQLAGLPRSQ
QQRHLPFFLEKKGESSRKHRYPQSMWEPEGKELQLDQEERAPWIEIFLGNSTPSTQGQGK
GAMGTQKEVIGMEAEVTGVLLVAEGQRTTEGTHKKEAEWSHVQRLLMPSPRGAVEGAVSG
SRQGSGGSSILGEPWVLQGHATKEDSTVENPQVQTEVTLVARREEQAEVSLQDEIKSLRL
GLRKAEEQAQRQEQLLREQEGELQALREQLSRCQEERAELQAQLEQKQQEAERRDAMYQE
ELGGQRDLVQAMKRRVLELIQEKDRLWQRLQHLSSMAPECCVACSKIFGRFSRRYPCRLC
GGLLCHACSMDYKKRDRCCPPCAQGREAQVT
Download sequence
Identical sequences Q6ZNE9
NP_940885.2.87134 NP_940885.2.92137 XP_011509316.1.92137 XP_016859385.1.92137 gi|282165733|ref|NP_940885.2| ENSP00000345900 ENSP00000345900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]