SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000347999 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000347999
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 2.48e-17
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 
Domain Number 2 Region: 846-885
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000114
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 904-932
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.004
Further Details:      
 
Domain Number 4 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000471
Family CCCH zinc finger 0.0059
Further Details:      
 
Weak hits

Sequence:  ENSP00000347999
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0608
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000347999   Gene: ENSG00000122299   Transcript: ENST00000355758
Sequence length 971
Comment pep:known chromosome:GRCh38:16:11750586:11797267:-1 gene:ENSG00000122299 transcript:ENST00000355758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLRALVRNLFNEGNDVYREHDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSLNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESALPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQIMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSQKNEKSEDIASQSNKEN
GKQIHMPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFP
TGYFSICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDF
GKYSFLFKDLN
Download sequence
Identical sequences Q8IWR0
gi|27414497|ref|NP_054872.2| ENSP00000347999 9606.ENSP00000347999 NP_054872.2.87134 NP_054872.2.92137 XP_006720940.1.92137 XP_011520765.1.92137 ENSP00000347999 ENSP00000379773 ENSP00000347999 ENSP00000379773 NYSGRC-27414497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]