SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSP00000349359 from Homo sapiens 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSP00000349359
Domain Number 1 Region: 247-317
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.73e-17
Family SAM (sterile alpha motif) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000042
Family SH3-domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSP00000349359   Gene: ENSG00000122122   Transcript: ENST00000356892
Sequence length 380
Comment pep:known chromosome:GRCh38:X:129779984:129795201:1 gene:ENSG00000122122 transcript:ENST00000356892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKPSNASEKEPTQKKKLSLQRSSSFKDFAKSKPSSPVVSEKEFNLDDNIPEDDSGVP
TPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMADTLEEGSASPTSPDYSLDS
PGPEKMALAFSEQEEHELPVLSRQASTGSELCSPSPGSGSFGEEPPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGKVGSFKFIYVDVLPEEAVGHA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPKVDIPRDSGCFEGSESGRD
DAELAGTEEQLQGLSLAGAP
Download sequence
Identical sequences O75995
9606.ENSP00000349359 gi|9506363|ref|NP_061863.1| ENSP00000349359 ENSP00000349359 ENSP00000349359 NP_061863.1.87134 NP_061863.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]